PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A13G0794
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 285aa    MW: 31947.1 Da    PI: 7.7179
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A13G0794genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.82.5e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd llv +v+++G+g+W++++   g+ R+ k+c++rw +yl
      Gh_A13G0794 14 KGPWTPEEDILLVSYVQEHGPGNWRLVPTNTGLQRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding46.21e-1467112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E+  ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
      Gh_A13G0794  67 RGNFTPHEEGMIIHLQALLGNK-WAAIASYLP-QRTDNDVKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-24564IPR009057Homeodomain-like
PROSITE profilePS5129426.424965IPR017930Myb domain
SuperFamilySSF466891.84E-3111108IPR009057Homeodomain-like
SMARTSM007172.6E-141363IPR001005SANT/Myb domain
PfamPF002494.8E-171461IPR001005SANT/Myb domain
CDDcd001671.17E-111661No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2465117IPR009057Homeodomain-like
PROSITE profilePS5129418.65266116IPR017930Myb domain
SMARTSM007173.2E-1366114IPR001005SANT/Myb domain
PfamPF002494.6E-1367112IPR001005SANT/Myb domain
CDDcd001673.80E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MGRSPCCDKV GIKKGPWTPE EDILLVSYVQ EHGPGNWRLV PTNTGLQRCS KSCRLRWTNY  60
LRPGIKRGNF TPHEEGMIIH LQALLGNKWA AIASYLPQRT DNDVKNYWNT HLKKKLKKFQ  120
PAMELPQMAQ ACLNKTLATG SSSTIATYAS STENISRLLQ GWMRASPNIC SNQSAIILQT  180
QSKDESGGGD LMSNEHFESI LWFENMNNVA WEKSACGSTT SKGGFQDSGN DDQFSVEITQ  240
EMKQKTGNNS KFYPSFSSLE KWLLDDSCAG QVEEMNQSME LSPIF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C9e-25141164105C-Myb DNA-Binding Domain
1mse_C9e-25141164105C-Myb DNA-Binding Domain
1gv2_A9e-25141164105MYB PROTO-ONCOGENE PROTEIN
1h8a_C1e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012461145.10.0PREDICTED: myb-related protein 306-like
SwissprotP813926e-81MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0B0NRD80.0A0A0B0NRD8_G
STRINGPOPTR_0013s06390.11e-122(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.12e-96myb domain protein 60